Antibodies

Jump to Filters
View as table Download
OR10H4 Rabbit Polyclonal Antibody
TA316079

USD 380.00

In Stock

Rabbit polyclonal anti-OR10H4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10H4.
OR10H4 Rabbit Polyclonal Antibody
TA332323

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR10H4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10H4 Antibody is: synthetic peptide directed towards the middle region of Human OR10H4. Synthetic peptide located within the following region: HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRI