Antibodies

Jump to Filters
View as table Download
VENTX Rabbit Polyclonal Antibody
TA319895

USD 570.00

5 Days

Rabbit Polyclonal VENTX Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VENTX antibody was raised against a 16 amino acid synthetic peptide near the center of human VENTX.
VENTX Rabbit Polyclonal Antibody
TA339467

USD 539.00

5 Days

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: VAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDA
VENTX Rabbit Polyclonal Antibody
TA339468

USD 539.00

5 Days

Rabbit Polyclonal Anti-VENTX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE