Germany
Japan
United Kingdom
China
Antibodies
View as table Download
FEN1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FEN1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FEN1 mouse monoclonal antibody, clone OTI2B2 (formerly 2B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal FEN1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This FEN1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-272 amino acids from the Central region of human FEN1. |
FEN1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit anti-FEN1 Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FEN1 |
Rabbit Polyclonal Anti-FEN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FEN1 antibody: synthetic peptide directed towards the C terminal of human FEN1. Synthetic peptide located within the following region: PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL |
FEN1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- FEN1
Applications
- WB
Conjugates
- Unconjugated
Families
- Stem cell - Pluripotency