Antibodies

View as table Download

Anti-IAPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-52 amino acids of Human Islet amyloid polypeptide

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Goat Polyclonal Anti-INS Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human Insulin produced in E. coli as a fusion protein.

Insulin (INS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-IAPP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IAPP antibody: synthetic peptide directed towards the N terminal of human IAPP. Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV