FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Amphiphysin (amphiphysin)
Applications | IHC, WB |
Reactivities | Human (Predicted: Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418) |
Anti-AMPH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin |
Anti-AMPH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin |
Rabbit Polyclonal Anti-GSN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
FCGR3A mouse monoclonal antibody, clone OTI2A2
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FCGR3A mouse monoclonal antibody, clone OTI12D8
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal AMPH antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPH. |
Rabbit anti-AMPH Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AMPH |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against Amphiphysin / AMPH
Applications | WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KRKDESRISKAE, from the internal region of the protein sequence according to NP_001626.1; NP_647477.1. |
Goat Polyclonal Antibody against GSN
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1. |