Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IL24 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI5C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4D1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI5C8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI3C5
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IL24 mouse monoclonal antibody,clone OTI4H4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
IL24 mouse monoclonal antibody,clone OTI4E1
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit Polyclonal Anti-IL24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT |
Active filters
Target Symbol
- IL24
Applications
- WB
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- Cytokine-cytokine receptor interaction