PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PHKG2 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PHKG2 |
PHKG2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PHKG2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PHKG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV |