Antibodies

Jump to Filters
View as table Download
GPR27 Rabbit Polyclonal Antibody
TA313949

USD 380.00

In Stock

Rabbit polyclonal anti-GPR27 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR27.
GPR27 Rabbit Polyclonal Antibody
TA342542

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the N terminal of human GPR27. Synthetic peptide located within the following region: MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLH
GPR27 Rabbit Polyclonal Antibody
TA342543

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAV
GPR27 Rabbit Polyclonal Antibody
TA342544

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV