Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Applications | Electron Microscopy, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the c-terminus of rat SSR2. |
Rabbit Polyclonal Somatostatin Receptor 2 Antibody
Applications | Electron Microscopy, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the c-terminus of rat SSR2. |
Anti-SSTR2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
Somatostatin Receptor 2 (SSTR2) rabbit polyclonal antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SSTR2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
Rabbit Polyclonal Anti-SSTR2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSTR2 antibody: synthetic peptide directed towards the middle region of human SSTR2. Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |