Antibodies

Jump to Filters
View as table Download
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA310081

USD 360.00

3 Weeks

Rabbit anti-TGFB1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide coupled to KLH
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA342296

USD 485.00

5 Days

Rabbit Polyclonal Anti-Tgfb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA347822

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.