Antibodies

View as table Download

PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCCA mouse monoclonal antibody,clone OTI1B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PCCA mouse monoclonal antibody,clone OTI1B10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PCCA mouse monoclonal antibody,clone OTI1E9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PCCA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA

Rabbit Polyclonal Anti-PCCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCCA Antibody: synthetic peptide directed towards the N terminal of human PCCA. Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI