Rabbit Polyclonal Anti-WIPI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WIPI1 antibody: synthetic peptide directed towards the middle region of human WIPI1. Synthetic peptide located within the following region: LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRG |
Rabbit Polyclonal Anti-WIPI1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WIPI1 antibody: synthetic peptide directed towards the N terminal of human WIPI1. Synthetic peptide located within the following region: AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN |
WIPI1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human WIPI1 |
WIPI1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WIPI1 |
WIPI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 187-446 of human WIPI1 (NP_060453.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
