Rabbit Polyclonal Anti-RUVBL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI |
Rabbit Polyclonal Anti-RUVBL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUVBL2 antibody: synthetic peptide directed towards the N terminal of human RUVBL2. Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID |
RUVBL2 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human RUVBL2. |
Germany
Japan
United Kingdom
China
