Antibodies

Jump to Filters
View as table Download
PRKX Rabbit Polyclonal Antibody
TA350786

USD 380.00

In Stock

Rabbit Polyclonal Anti-PRKX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PRKX
PRKX Rabbit Polyclonal Antibody
TA314392

USD 380.00

In Stock

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.
PRKX (C-term) Rabbit Polyclonal Antibody
AP14820PU-N

USD 580.00

2 Weeks

PRKX (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human PRKX.
PRKX Rabbit Polyclonal Antibody
TA342239

USD 539.00

5 Days

Rabbit polyclonal Anti-PRKX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKX antibody: synthetic peptide directed towards the N terminal of human PRKX. Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
PRKX Rabbit Polyclonal Antibody
TA362115

USD 539.00

5 Days

PRKX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRKX
PRKX Rabbit Polyclonal Antibody
TA380383

USD 365.00

3 Weeks

PRKX Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 239-358 of human PRKX (NP_005035.1).
Modifications Unmodified