Antibodies

View as table Download

Rabbit Polyclonal Anti-DDX42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM

DDX42 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human DDX42