Antibodies

Jump to Filters
View as table Download
PNMA6A Rabbit Polyclonal Antibody
TA343035

USD 539.00

5 Days

Rabbit Polyclonal Anti-PNMA6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNMA6A antibody: synthetic peptide directed towards the N terminal of human PNMA6A. Synthetic peptide located within the following region: FTVLGKVFREEDNATAALVELDREVNYALVPREIPGTGGPWNVVFVPRCS
PNMA6A Rabbit Polyclonal Antibody
TA357729

USD 539.00

5 Days

PNMA6A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PNM6A