Antibodies

Jump to Filters
View as table Download
ITPK1 Rabbit Polyclonal Antibody
TA308666

USD 625.00

5 Days

Rabbit Polyclonal antibody to ITPK1 (inositol 1,3,4-triphosphate 5/6 kinase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 171 and 414 of ITPK1 (Uniprot ID#Q13572)
ITPK1 Rabbit Polyclonal Antibody
TA314101

USD 380.00

4 Weeks

Rabbit polyclonal anti-ITPK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ITPK1.
ITPK1 Rabbit Polyclonal Antibody
TA334502

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1. Synthetic peptide located within the following region: MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI
ITPK1 Rabbit Polyclonal Antibody
TA347681

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITPK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ITPK1 Antibody: A synthesized peptide derived from human ITPK1