Antibodies

Jump to Filters
View as table Download
RFXAP Rabbit Polyclonal Antibody
TA332359

USD 539.00

5 Days

Rabbit Polyclonal Anti-RFXAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE
RFXAP Rabbit Polyclonal Antibody
TA362830

USD 539.00

5 Days

RFXAP Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RFXAP