Antibodies

Jump to Filters
View as table Download
KCNJ1 Rabbit Polyclonal Antibody
TA338741

USD 539.00

5 Days

Rabbit Polyclonal Anti-KCNJ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
KCNJ1 Goat Polyclonal Antibody
TA305615

USD 520.00

5 Days

Goat Anti-KCNJ1 / ROMK Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQININFVVDAGNEN , from the internal region of the protein sequence according to NP_000211.1; NP_722448.1.