HSD17B12 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
HSD17B12 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
Rabbit Polyclonal Anti-HSD17B12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |