Antibodies

Jump to Filters
View as table Download
PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody
TA349651

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIP4K2A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP4K2A
PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody
TA342234

USD 539.00

5 Days

Rabbit polyclonal Anti-PIP4K2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
PIP5K2 alpha (PIP4K2A) Rabbit Polyclonal Antibody
TA342235

USD 539.00

5 Days

Rabbit polyclonal Anti-PIP4K2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the middle region of human PIP4K2A. Synthetic peptide located within the following region: EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNI