Antibodies

View as table Download

Rabbit polyclonal anti-OR6Q1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR6Q1.

Rabbit Polyclonal Anti-OR6Q1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR6Q1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR6Q1. Synthetic peptide located within the following region: FMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVFS

Rabbit Polyclonal Anti-OR6Q1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR6Q1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR6Q1. Synthetic peptide located within the following region: FFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVF