Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Goat Anti-CAMK2A Antibody
| Applications | FC, IF, PEP-ELISA, WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTAQSEETRVWHR, from the internal region of the protein sequence according to NP_057065.2; NP_741960.1. |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
