Antibodies

Jump to Filters
View as table Download
TBPL1 Rabbit Polyclonal Antibody
TA339104

USD 485.00

5 Days

Rabbit Polyclonal Anti-TBPL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBPL1 antibody: synthetic peptide directed towards the middle region of human TBPL1. Synthetic peptide located within the following region: LQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPA
TBPL1 Goat Polyclonal Antibody
TA302827

USD 520.00

5 Days

Goat Polyclonal Antibody against TBPL1

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QIYPFVFESRKEIL, from the C Terminus of the protein sequence according to NP_004856.