Antibodies

Jump to Filters
View as table Download
Lysophospholipase 1 (LYPLA1) Rabbit Polyclonal Antibody
TA312315

USD 380.00

4 Weeks

Rabbit polyclonal anti-LYPLA1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LYPLA1.
Lysophospholipase 1 (LYPLA1) Rabbit Polyclonal Antibody
TA340098

USD 539.00

5 Days

Rabbit Polyclonal Anti-LYPLA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYPLA1 antibody: synthetic peptide directed towards the middle region of human LYPLA1. Synthetic peptide located within the following region: SWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ