Antibodies

Jump to Filters
View as table Download
LIS1 (PAFAH1B1) Rabbit Polyclonal Antibody
TA306455

USD 570.00

5 Days

Rabbit Polyclonal LIS1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LIS1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human LIS1.
LIS1 (PAFAH1B1) Rabbit Polyclonal Antibody
TA335148

USD 539.00

5 Days

Rabbit polyclonal Anti-PAFAH1B1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL
LIS1 (PAFAH1B1) Rabbit Polyclonal Antibody
TA335149

USD 539.00

5 Days

Rabbit polyclonal Anti-PAFAH1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF