Antibodies

Jump to Filters
View as table Download
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA342728

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA313696

USD 380.00

4 Weeks

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.