Antibodies

View as table Download

Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase

Applications WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1.

Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal Anti-ALOX5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY

Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523
Modifications Phospho-specific

Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523.
Modifications Phospho-specific