Antibodies

Jump to Filters
View as table Download
WASF3 Rabbit Polyclonal Antibody
TA315109

USD 380.00

In Stock

Rabbit polyclonal anti-WASF3 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human WASF3.
WASF3 Rabbit Polyclonal Antibody
TA340126

USD 539.00

5 Days

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
WASF3 Rabbit Polyclonal Antibody
TA340127

USD 539.00

5 Days

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Human, Chicken, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS