Rabbit Polyclonal Anti-SLC1A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5. Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV |
Anti-SLC1A5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 211-224 amino acids of human solute carrier family 1 (neutral amino acid transporter), member 5 |
SLC1A5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC1A5 |
Germany
Japan
United Kingdom
China
