ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10 |
ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10 |
Rabbit Polyclonal Anti-ALG10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM |