Interferon beta (IFNB1) rabbit polyclonal antibody
Applications | ELISA, FN, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Interferon beta (IFNB1) rabbit polyclonal antibody
Applications | ELISA, FN, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 50-100 of Human RANTES. |
Rabbit Polyclonal TREX1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TREX1 antibody was raised against a 15 amino acid peptide near the center of human TREX1. |
Rabbit Polyclonal VISA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA. |
Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly purified (>98%) E.coli derived recombinant Human Inferferon beta. |
Interferon beta (IFNB1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly purified (>98%) E.coli derived recombinant Human Inferferon beta. |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAVS |
Rabbit Polyclonal VISA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA. |
Rabbit Polyclonal CCL4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4. |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
Interferon beta (IFNB1) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A 17 amino acid peptide located near the centre of human Interferon beta. |
Interferon beta (IFNB1) rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (> 98%) E.coli derived recombinant Human IFN beta |
USD 580.00
5 Days
Rabbit polyclonal CCL4 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CCL4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-48 amino acids from the Central region of human CCL4. |
Rabbit Polyclonal Anti-MAVS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit anti-MAVS Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAVS |