Antibodies

View as table Download

Rabbit Polyclonal anti-EPHA3 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EPHA3

Rabbit Polyclonal anti-EPHA3 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EPHA3

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-EPHA3 antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA3.

Rabbit polyclonal EPHA3 (Ab-602) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPHA3.

Rabbit Polyclonal Anti-EPHA3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA3 Antibody: A synthesized peptide derived from human EPHA3

Rabbit Polyclonal Anti-EPHA3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EPHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA3. Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT