Antibodies

Jump to Filters
View as table Download
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA306839

USD 570.00

2 Weeks

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA346383

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-AGTR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI
Angiotensin II Type 1 Receptor (AGTR1) Goat Polyclonal Antibody
TA303151

USD 520.00

In Stock

Goat Polyclonal Antibody against AGTR1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EIQKNKPRNDDIFK, from the internal region of the protein sequence according to NP_000676.1; NP_004826.2; NP_033611.1; NP_114038.1; NP_114438.1.
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA321178

USD 380.00

In Stock

Anti-AGTR1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 301-359 amino acids of human angiotensin II receptor, type 1angiotensin II receptor, type 1