Antibodies

Jump to Filters
View as table Download
IL13 receptor alpha 1 (IL13RA1) Rabbit Polyclonal Antibody
TA321373

USD 380.00

4 Weeks

Anti-IL13RA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-363 amino acids of Human Interleukin 13 receptor, alpha 1
IL13 receptor alpha 1 (IL13RA1) Rabbit Polyclonal Antibody
TA343310

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL13RA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IL13RA1 antibody is: synthetic peptide directed towards the N-terminal region of IL13RA1. Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
IL13 receptor alpha 1 (IL13RA1) Rabbit Polyclonal Antibody
TA314081

USD 380.00

4 Weeks

Rabbit polyclonal IL-13R/CD213a1 (Tyr405) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-13R/CD213a1 around the phosphorylation site of tyrosine 405 (D-I-YP-E-K).
Modifications Phospho-specific