Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH |
USD 580.00
5 Days
Rabbit polyclonal CCL4 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CCL4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-48 amino acids from the Central region of human CCL4. |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit anti-MAVS Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAVS |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit polyclonal MIP-1 beta antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human MIP-1β protein. |
Active filters
Reactivities
- Human
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Cytosolic DNA-sensing pathway