Antibodies

Jump to Filters
View as table Download
p53 (TP53) Rabbit Polyclonal Antibody
TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
MITF Rabbit Polyclonal Antibody
TA314196

USD 380.00

In Stock

Rabbit polyclonal MITF (Ab-180/73) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M).
MITF Rabbit Polyclonal Antibody
TA323767

USD 380.00

2 Weeks

Anti-MITF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 173 amino acids of human matrix metallopeptidase 28
p53 (TP53) Rabbit Polyclonal Antibody
TA327567

USD 365.00

3 Weeks

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
MDM2 Rabbit Polyclonal Antibody
TA311995

USD 380.00

In Stock

Rabbit polyclonal anti-MDM2 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MDM2.
p53 (TP53) Rabbit Polyclonal Antibody
TA329141

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
p53 (TP53) Goat Polyclonal Antibody
AB0154-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA324776

USD 580.00

5 Days

Rabbit polyclonal Phospho-p53(T18) Antibody

Applications Dot, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Monkey, Rabbit)
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53.
Modifications Phospho-specific
p53 (TP53) Rabbit Polyclonal Antibody
TA324825

USD 580.00

5 Days

Rabbit polyclonal p53 Antibody (S315)

Applications IF, IHC, WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53.
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
E2F3 Rabbit Polyclonal Antibody
TA349084

USD 570.00

5 Days

Rabbit Polyclonal Anti-E2F3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3.
p53 (TP53) Goat Polyclonal Antibody
AB0065-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
p53 (TP53) Rabbit Polyclonal Antibody
TA326087

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-15) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15.