Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This CREB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 105-132 amino acids from the Central region of human CREB1. |
Rabbit polyclonal CREB phospho S133 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CREB phospho peptide corresponding to amino acid residues 122-147 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
| Modifications | Phospho-specific |
Rabbit polyclonal NFYB Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This NFYB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 17-46 amino acids from the N-terminal region of human NFYB. |
Rabbit Polyclonal Anti-NFYC Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFYC antibody: synthetic peptide directed towards the C terminal of human NFYC. Synthetic peptide located within the following region: GTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPA |
Rabbit polyclonal CREB (Ab-100) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
Rabbit polyclonal anti-NFYA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFYA. |
Rabbit Polyclonal CREB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal CREB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 133 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Applications
- WB
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transcription Factors
Pathways
- Antigen processing and presentation