BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit Polyclonal BMP-2 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
BMP7 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide cooresponding aa 140-190 of human BMP7 |
BMP2 (+ BMP4) rabbit polyclonal antibody, Purified
Applications | ELISA, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4. |
GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5 |
Rabbit Polyclonal Anti-BMP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit anti-BMP7 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP7 |
Rabbit polyclonal anti-BMP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP2 |
BMP7 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
BMP7 rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli. |
Rabbit Polyclonal Anti-GDF5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP |
GDF5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GDF5 |
Rabbit polyclonal anti-BMP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP2 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".