Rabbit Polyclonal Anti-CDC25A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25A |
Rabbit Polyclonal Anti-CDC25A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25A |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25B |
Rabbit polyclonal CDC25A (Ab-178) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Rabbit Polyclonal CDC25A (Ser124) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 124 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CC14A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CC14A. |
Rabbit Polyclonal CDC25A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A |
Rabbit Polyclonal CDC25A (Ser178) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 178 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 75 |
Modifications | Phospho-specific |
Rabbit Polyclonal CDC25B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B |
Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323 |
Modifications | Phospho-specific |