Antibodies

Jump to Filters
View as table Download
SREB3 (GPR173) Rabbit Polyclonal Antibody
TA315518

USD 380.00

In Stock

Rabbit polyclonal anti-GPR173 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR173.
SREB3 (GPR173) Rabbit Polyclonal Antibody
TA315517

USD 380.00

4 Weeks

Rabbit polyclonal anti-GPR173 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR173.
SREB3 (GPR173) Rabbit Polyclonal Antibody
TA331845

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPR173 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV