Antibodies

Jump to Filters
View as table Download
PAX4 Rabbit Polyclonal Antibody
TA329888

USD 539.00

5 Days

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA
PAX4 Goat Polyclonal Antibody
TA311354

USD 520.00

5 Days

Goat Anti-PAX4 Antibody

Applications ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKLATATSLPEDTVR, from the internal region of the protein sequence according to NP_006184.2.