Rabbit Polyclonal Anti-ITGAV Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse, Bovine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Rabbit polyclonal anti-ACTN1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1. |
Rabbit polyclonal ITGA5 (heavy chain, Cleaved-Phe42) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA5. |
Germany
Japan
United Kingdom
China
