Rabbit Polyclonal 5-Lipoxygenase Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within residues 100-200 of human 5-Lipoxygenase. [Swiss-Prot# P09917] |
Rabbit Polyclonal 5-Lipoxygenase Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within residues 100-200 of human 5-Lipoxygenase. [Swiss-Prot# P09917] |
Rabbit Polyclonal 5-Lipoxygenase Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 600-674 of human 5-Lipoxygenase. [Swiss-Prot# P09917] |
Goat Polyclonal Antibody against Arachidonate 5-lipoxygenase
Applications | WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERNKKKQLPYYYLSPD, from the C Terminus of the protein sequence according to NP_000689.1. |
Rabbit Anti-5-Lipoxygenase (Ser523) Antibody (Phospho-Specific)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser523 conjugated to KLH |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ALOX5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALOX5 antibody is: synthetic peptide directed towards the C-terminal region of Human ALOX5. Synthetic peptide located within the following region: FGQLFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYY |
Rabbit Polyclonal Anti-Phospho-ALOX5(Ser523) Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-ALOX5(Ser523) Antibody: A synthesized peptide derived from human ALOX5 around the phosphorylation site of Sersine 523 |
Modifications | Phospho-specific |
Rabbit polyclonal ALOX5 (Phospho-Ser523) antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ALOX5 around the phosphorylation site of serine523. |
Modifications | Phospho-specific |