Antibodies

View as table Download

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Rabbit Polyclonal Anti-AHCYL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE