Antibodies

View as table Download

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pdgfc antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pdgfc. Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV

Rabbit Polyclonal Anti-PDGFC Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS

Rabbit Polyclonal Anti-EGFR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
Modifications Phospho-specific

Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R).
Modifications Phospho-specific

Rabbit polyclonal EGFR (Tyr869) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 869 (K-E-YP-H-A).
Modifications Phospho-specific

Rabbit polyclonal EGFR (Tyr1110) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1110 (P-V-YP-H-N).
Modifications Phospho-specific