Antibodies

View as table Download

ZBTB2 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ZBTB2

Rabbit Polyclonal ZBTB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ZBTB2 antibody was raised against a 14 amino acid peptide near the center of human ZBTB2.

Rabbit Polyclonal Anti-ZBTB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB2 antibody: synthetic peptide directed towards the middle region of human ZBTB2. Synthetic peptide located within the following region: VKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIKKEQETVLL