Antibodies

Jump to Filters
View as table Download
EFTUD2 (Center) Rabbit Polyclonal Antibody
AP51383PU-N

USD 580.00

2 Weeks

EFTUD2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 263~293 amino acids from the Center region of human EFTUD2
EFTUD2 Rabbit Polyclonal Antibody
TA335754

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFTUD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EFTUD2 Antibody is: synthetic peptide directed towards the middle region of Human EFTUD2. Synthetic peptide located within the following region: ADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPL