Antibodies

Jump to Filters
View as table Download
AMD1 (C-term) Rabbit Polyclonal Antibody
AP23364PU-N

USD 560.00

2 Weeks

AMD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human SAMDC
AMD1 Rabbit Polyclonal Antibody
TA334966

USD 539.00

5 Days

Rabbit Polyclonal Anti-AMD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMD1 antibody: synthetic peptide directed towards the N terminal of human AMD1. Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV
AMD1 Rabbit Polyclonal Antibody
TA357170

USD 539.00

5 Days

AMD1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated