Rabbit polyclonal FGR Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 3-33 amino acids from the N-terminal region of human FGR. |
Rabbit polyclonal anti-FGR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FGR. |
Rabbit anti-FGR Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human FGR |
Goat Polyclonal Antibody against FGR
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TSAEPQYQPGDQT, from the C Terminus of the protein sequence according to NP_005239. |
Rabbit Polyclonal Anti-FGR Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FGR antibody: synthetic peptide directed towards the middle region of human FGR. Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ |
Germany
Japan
United Kingdom
China
